Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPREB3 Peptide - middle region

VPREB3 Peptide - middle region

Product Specifications

Product Name Alternative

VPREB3, UNQ355/PRO619

UniProt

Q9UKI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPREB3 Rabbit Polyclonal Antibody (orb331348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037510

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NrCAM Rabbit Monoclonal Antibody
MA4042-.1 100 µL

Anti-NrCAM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CEP78 Lentiviral Activation Particles (h2)
sc-413559-LAC-2 200 µL

CEP78 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RNF39 Antibody, HRP conjugated
CSB-PA019888LB01HU-01 50 µg

RNF39 Antibody, HRP conjugated

Sign In for Pricing
View Details
RNF39 Antibody, HRP conjugated
CSB-PA019888LB01HU-02 100 µg

RNF39 Antibody, HRP conjugated

Sign In for Pricing
View Details
Clara Cell Protein 16 (CC16) Magnetic Fluorescence Assay Kit
MBS2156509-01 96 Tests

Clara Cell Protein 16 (CC16) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Clara Cell Protein 16 (CC16) Magnetic Fluorescence Assay Kit
MBS2156509-02 5x 96 Tests

Clara Cell Protein 16 (CC16) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details