Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC1 Peptide - C-terminal region

LRRC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC1, LANO

UniProt

Q9BTT6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC1 Rabbit Polyclonal Antibody (orb326599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249264

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS630449 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
AZ 10606120 Dihydrochloride (~90%)
TRC-A795163-2.5MG 2.5 mg

AZ 10606120 Dihydrochloride (~90%)

Sign In for Pricing
View Details
2-Naphthyl Pyrovalerone Hydrochloride
TRC-N377700-5MG 5 mg

2-Naphthyl Pyrovalerone Hydrochloride

Sign In for Pricing
View Details
Swab Collection and DNA Preservation System (Bulk Format)
45690-B 50 Units

Swab Collection and DNA Preservation System (Bulk Format)

Sign In for Pricing
View Details
Human KRTAP2-4 activation kit by CRISPRa
GA113843 1 Kit

Human KRTAP2-4 activation kit by CRISPRa

Sign In for Pricing
View Details
L-Glutamine-13C
TRC-G597298-5MG 5 mg

L-Glutamine-13C

Sign In for Pricing
View Details