Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC1 Peptide - C-terminal region

LRRC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC1, LANO

UniProt

Q9BTT6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC1 Rabbit Polyclonal Antibody (orb326599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249264

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (LH2), 0.2mg/mL
BNUB0674-500 1x 500 µL

Cytokeratin 10 (LH2), 0.2mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF647 conjugate, 0.1mg/mL
BNC471747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC25A13 Rabbit Polyclonal Antibody
TA381595 100 µL

SLC25A13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DUSP15 activation kit by CRISPRa
GA115063 1 Kit

Human DUSP15 activation kit by CRISPRa

Sign In for Pricing
View Details
Nitrovin Hydrochloride
TRC-N494710-50MG 50 mg

Nitrovin Hydrochloride

Sign In for Pricing
View Details
Rpl26 (BC070397) Mouse Tagged ORF Clone
MG200968 10 µg

Rpl26 (BC070397) Mouse Tagged ORF Clone

Sign In for Pricing
View Details