Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEGF9 Peptide - C-terminal region

MEGF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MEGF9, EGFL5, KIAA0818, UNQ671/PRO1305

UniProt

Q9H1U4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEGF9 Rabbit Polyclonal Antibody (orb586556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073966

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILVSNASLTTSVPTPVINSTFTPTTLQTIFSVSTSENSTSALADVSWTQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYZ Rabbit pAb
E2513511 100 µL

LYZ Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal AIF Antibody (22E9) [PE]
NBP2-59432PE 0.1 mL

Mouse Monoclonal AIF Antibody (22E9) [PE]

Sign In for Pricing
View Details
Human RFX2 qPCR Primer Pair
QH21585S 200 Tests

Human RFX2 qPCR Primer Pair

Sign In for Pricing
View Details
N1- (2-chloroethanimidoyl) -3,5-dichloro-4- (4-nitrophenoxy) benzene-1-sulphonamide
OR21305 1 Each

N1- (2-chloroethanimidoyl) -3,5-dichloro-4- (4-nitrophenoxy) benzene-1-sulphonamide

Sign In for Pricing
View Details
Rabbit Monoclonal LIMPII/SR-B2 Antibody (052) [DyLight 488]
NBP2-90382G 0.1 mL

Rabbit Monoclonal LIMPII/SR-B2 Antibody (052) [DyLight 488]

Sign In for Pricing
View Details
Rabbit Polyclonal beta-Arrestin 2 Antibody [mFluor Violet 500 SE]
NBP2-24569MFV500 0.1 mL

Rabbit Polyclonal beta-Arrestin 2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details