Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY4R Peptide - N-terminal region

NPY4R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPY4R, PPYR1

UniProt

P50391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY4R Rabbit Polyclonal Antibody (orb586570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD488 NHS Ester
71902-AAT 5 mg

XFD488 NHS Ester

Sign In for Pricing
View Details
CABP5 Rabbit Polyclonal Antibody
TA369891 100 µL

CABP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Bromophenylboronic Acid
TRC-B687625-5G 5 g

3-Bromophenylboronic Acid

Sign In for Pricing
View Details
Polystyrene A COOH
HA50056003.100G 100 g

Polystyrene A COOH

Sign In for Pricing
View Details
ReadiLink™ Protein Conjugation Stop Buffer
5400-AAT 1 mL

ReadiLink™ Protein Conjugation Stop Buffer

Sign In for Pricing
View Details
CD45RB (PD7/26), CF740 conjugate, 0.1mg/mL
BNC740472-100 1x 100 µL

CD45RB (PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details