Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY4R Peptide - N-terminal region

NPY4R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPY4R, PPYR1

UniProt

P50391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY4R Rabbit Polyclonal Antibody (orb586570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofilin (IMMT) Rabbit Polyclonal Antibody
TA377492 100 µL

Mitofilin (IMMT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VAMP3 Mouse Monoclonal Antibody [Clone ID: ATG4G9]
AM09051PU-N 100 µL

VAMP3 Mouse Monoclonal Antibody [Clone ID: ATG4G9]

Sign In for Pricing
View Details
SOCS2 (NM_003877) Human Over-expression Lysate
LY401278 100 µg

SOCS2 (NM_003877) Human Over-expression Lysate

Sign In for Pricing
View Details
NRF1 (NRF1/2609), 1mg/mL
BNUM2609-50 1x 50 µL

NRF1 (NRF1/2609), 1mg/mL

Sign In for Pricing
View Details
Cystatin C Human ELISA Kit
K012-H1 1 Plate

Cystatin C Human ELISA Kit

Sign In for Pricing
View Details
COMT Antibody
8C14991-AAT 50 µg

COMT Antibody

Sign In for Pricing
View Details