Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49 Peptide - N-terminal region

TRIM49 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRIM49, RNF18

UniProt

P0CI25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49 Rabbit Polyclonal Antibody (orb587857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065091

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA4 Human Gene Knockout Kit (CRISPR)
KN417805 1 Kit

PCDHGA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709022 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CRYGD (NM_006891) Human Recombinant Protein
TP322889 20 µg

CRYGD (NM_006891) Human Recombinant Protein

Sign In for Pricing
View Details
MGMT Antibody
KC-7969-01 50 μL

MGMT Antibody

Sign In for Pricing
View Details
MGMT Antibody
KC-7969-02 100 µL

MGMT Antibody

Sign In for Pricing
View Details
MGMT Antibody
KC-7969-03 1 mL

MGMT Antibody

Sign In for Pricing
View Details