Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49 Peptide - N-terminal region

TRIM49 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRIM49, RNF18

UniProt

P0CI25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49 Rabbit Polyclonal Antibody (orb587857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065091

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone
CS707088 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
Rnf41 (BC019415) Mouse Tagged ORF Clone
MG201892 10 µg

Rnf41 (BC019415) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLC6A19 (NM_001003841) Human Over-expression Lysate
LY424027 100 µg

SLC6A19 (NM_001003841) Human Over-expression Lysate

Sign In for Pricing
View Details
EGR1 Mouse Monoclonal Antibody [Clone ID: 8A6]
AM06427SU-N 100 µL

EGR1 Mouse Monoclonal Antibody [Clone ID: 8A6]

Sign In for Pricing
View Details
ZNF678 (C-term) Rabbit Polyclonal Antibody
AP54712PU-N 400 µL

ZNF678 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXO3 Human Gene Knockout Kit (CRISPR)
KN202894LP 1 Kit

FOXO3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details