Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP5 Peptide - C-terminal region

LAMP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAMP5, C20orf103

UniProt

Q9UJQ1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAMP5 Rabbit Polyclonal Antibody (orb327187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036393

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1E1 Polyclonal Antibody
E-AB-18404-01 20 µL

EEF1E1 Polyclonal Antibody

Sign In for Pricing
View Details
EEF1E1 Polyclonal Antibody
E-AB-18404-02 60 µL

EEF1E1 Polyclonal Antibody

Sign In for Pricing
View Details
EEF1E1 Polyclonal Antibody
E-AB-18404-03 120 µL

EEF1E1 Polyclonal Antibody

Sign In for Pricing
View Details
EEF1E1 Polyclonal Antibody
E-AB-18404-04 200 µL

EEF1E1 Polyclonal Antibody

Sign In for Pricing
View Details
MRP2 (ABCC2) Human Gene Knockout Kit (CRISPR)
KN418976 1 Kit

MRP2 (ABCC2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DCTN2 Antibody (HRP)
KH-3199-01 50 μL

DCTN2 Antibody (HRP)

Sign In for Pricing
View Details