LAMP5 Peptide - C-terminal region
LAMP5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LAMP5, C20orf103
UniProt
Q9UJQ1
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAMP5 Rabbit Polyclonal Antibody (orb327187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036393
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Fyn Rabbit Monoclonal Antibody [Clone ID: R07-9I2]](https://cdn.genprice.uk/products/937/6868c2cf994c49e6dc3e75fe/imageurl/ta384273.webp)
![HOXD4 Mouse Monoclonal Antibody [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9085ff/imageurl/cf809489.webp)
CF809489 100 µg
HOXD4 Mouse Monoclonal Antibody [Clone ID: OTI1D12]
Sign In for Pricing
View Details 
BNCB2256-100 1x 100 µL
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details