Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAT2 Peptide - C-terminal region

SAT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAT2, SSAT2

UniProt

Q96F10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAT2 Rabbit Polyclonal Antibody (orb587927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597998

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B Polyclonal Antibody
D-AB-10235L-01 25 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
S100B Polyclonal Antibody
D-AB-10235L-02 100 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), 1mg/mL
BNUM2347-50 1x 50 µL

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), 1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF594 conjugate, 0.1mg/mL
BNC941670-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N6-Succinyl Adenosine-13C4
TRC-S688827-2.5MG 2.5 mg

N6-Succinyl Adenosine-13C4

Sign In for Pricing
View Details
Hexanoic Acid-d5
TRC-P237773-50MG 50 mg

Hexanoic Acid-d5

Sign In for Pricing
View Details