Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAT2 Peptide - C-terminal region

SAT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAT2, SSAT2

UniProt

Q96F10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAT2 Rabbit Polyclonal Antibody (orb587927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597998

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf2h5 (NM_181392) Mouse Tagged ORF Clone
MG200081 10 µg

Gtf2h5 (NM_181392) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NRG1 Human Gene Knockout Kit (CRISPR)
KN211372 1 Kit

NRG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SEPP1 (Selenoprotein P) ELISA Kit
E-EL-H2177-01 24 Tests

Human SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
Human SEPP1 (Selenoprotein P) ELISA Kit
E-EL-H2177-02 48 Tests

Human SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
Human SEPP1 (Selenoprotein P) ELISA Kit
E-EL-H2177-03 96 Tests

Human SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
GORASP2 (NM_015530) Human Over-expression Lysate
LY402446 100 µg

GORASP2 (NM_015530) Human Over-expression Lysate

Sign In for Pricing
View Details