Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPH3AL Peptide - C-terminal region

RPH3AL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPH3AL, NOC2

UniProt

Q9UNE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPH3AL Rabbit Polyclonal Antibody (orb587984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Girdin (Ser1417) Polyclonal Antibody, PE-Cy7 Conjugated
bs-6465R-PE-Cy7 100 µL

Phospho-Girdin (Ser1417) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
MIB2 Antibody (FITC)
orb517490-01 50 µg

MIB2 Antibody (FITC)

Sign In for Pricing
View Details
MIB2 Antibody (FITC)
orb517490-02 100 µg

MIB2 Antibody (FITC)

Sign In for Pricing
View Details
Lyn Polyclonal Antibody, PE-Cy7 Conjugated
bs-2906R-PE-Cy7-01 20 µL

Lyn Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Lyn Polyclonal Antibody, PE-Cy7 Conjugated
bs-2906R-PE-Cy7-02 100 µL

Lyn Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
PKN3 Antibody / Protein kinase N3
FY12860 100 µg

PKN3 Antibody / Protein kinase N3

Sign In for Pricing
View Details