Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPH3AL Peptide - C-terminal region

RPH3AL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPH3AL, NOC2

UniProt

Q9UNE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPH3AL Rabbit Polyclonal Antibody (orb587984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFRC Biosimilar Antibody
orb3182876-01 100 µg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details
TFRC Biosimilar Antibody
orb3182876-02 500 µg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details
TFRC Biosimilar Antibody
orb3182876-03 1 mg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details
TFRC Biosimilar Antibody
orb3182876-04 5 mg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details
TFRC Biosimilar Antibody
orb3182876-05 10 mg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details
TFRC Biosimilar Antibody
orb3182876-06 50 mg

TFRC Biosimilar Antibody

Sign In for Pricing
View Details