Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASEH2C Peptide - middle region

RNASEH2C Peptide - middle region

Product Specifications

Product Name Alternative

RNASEH2C, AYP1

UniProt

Q8TDP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNASEH2C Rabbit Polyclonal Antibody (orb327199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115569

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nkx3-2 activation kit by CRISPRa
GA200367 1 Kit

Mouse Nkx3-2 activation kit by CRISPRa

Sign In for Pricing
View Details
SPON1 (N-term) Rabbit Polyclonal Antibody
AP54519PU-N 400 µL

SPON1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
R 77975
TRC-R070125-10MG 10 mg

R 77975

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C4]
TA806348BM 100 µL

CSNK1G1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C4]

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (T8P2G4*A6), CF568 conjugate, 0.1mg/mL
BNC681802-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (T8P2G4*A6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granzyme B (GZMB) (C-term) Rabbit Polyclonal Antibody
AP17448PU-N 400 µL

Granzyme B (GZMB) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details