Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASEH2C Peptide - middle region

RNASEH2C Peptide - middle region

Product Specifications

Product Name Alternative

RNASEH2C, AYP1

UniProt

Q8TDP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNASEH2C Rabbit Polyclonal Antibody (orb327199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115569

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G3 Mouse Monoclonal Antibody [Clone ID: OTI4F2]
CF811652 100 µg

PLA2G3 Mouse Monoclonal Antibody [Clone ID: OTI4F2]

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF568 conjugate, 0.1mg/mL
BNC682761-100 1x 100 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-01 50 μL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-02 100 µL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-03 1 mL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Recombinant Human TIM-3/HAVCR2 Protein (mFc Tag)
PKSH033790-01 10 µg

Recombinant Human TIM-3/HAVCR2 Protein (mFc Tag)

Sign In for Pricing
View Details