Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUH Peptide - C-terminal region

CLUH Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLUH, KIAA0664

UniProt

O75153

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUH Rabbit Polyclonal Antibody (orb327209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056044

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSYPNPVAHLPADELVSKKRNKRRKNRPPGAADNTAWAVMTPQELWKNIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific (HepPar1), Biotin conjugate, 0.1mg/mL
BNCB0966-500 1x 500 µL

Hepatocyte Specific (HepPar1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF640R conjugate, 0.1mg/mL
BNC402166-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody
HA723340 100 µL

Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 3A4 Antibody
8C12277-AAT 50 µg

Cytochrome P450 3A4 Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (OKT3), CF568 conjugate, 0.1mg/mL
BNC680268-500 1x 500 µL

CD3e (T-Cell Marker) (OKT3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM47E Human Gene Knockout Kit (CRISPR)
KN426730 1 Kit

FAM47E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details