Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUH Peptide - C-terminal region

CLUH Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLUH, KIAA0664

UniProt

O75153

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUH Rabbit Polyclonal Antibody (orb327209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056044

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSYPNPVAHLPADELVSKKRNKRRKNRPPGAADNTAWAVMTPQELWKNIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peptide YY (PYY) Rabbit Polyclonal Antibody
TA371501 100 µL

Peptide YY (PYY) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-4356-01 50 μL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-4356-02 100 µL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-4356-03 1 mL

Transferrin Antibody

Sign In for Pricing
View Details
Mannose Phosphate Isomerase (MPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]
TA504771BM 100 µL

Mannose Phosphate Isomerase (MPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details
Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 20nm
GM-601-20 1 mL

Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 20nm

Sign In for Pricing
View Details