Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM41 Peptide - middle region

RBM41 Peptide - middle region

Product Specifications

Product Name Alternative

RBM41

UniProt

Q96IZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM41 Rabbit Polyclonal Antibody (orb588040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADKYMTSMKRKIKLGTKDEPQKKNKGDPMNNLESFYQEMIMKKRLEEFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSCP (ITGBL1) (NM_004791) Human Over-expression Lysate
LS009358-20ug 20 µg

OSCP (ITGBL1) (NM_004791) Human Over-expression Lysate

Sign In for Pricing
View Details
MGluR-3 Double Nickase Plasmid (h)
sc-404012-NIC 20 µg

MGluR-3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
GRAMD1C Polyclonal Antibody
MBS9235784-01 0.1 mL

GRAMD1C Polyclonal Antibody

Sign In for Pricing
View Details
GRAMD1C Polyclonal Antibody
MBS9235784-02 5x 0.1 mL

GRAMD1C Polyclonal Antibody

Sign In for Pricing
View Details
PCBD1 Rabbit Polyclonal Antibody (AP)
orb962053 100 µL

PCBD1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1341731-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details