Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM41 Peptide - middle region

RBM41 Peptide - middle region

Product Specifications

Product Name Alternative

RBM41

UniProt

Q96IZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM41 Rabbit Polyclonal Antibody (orb588040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADKYMTSMKRKIKLGTKDEPQKKNKGDPMNNLESFYQEMIMKKRLEEFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR-3D Polyclonal Antibody
RA30027-01 50 µL

SR-3D Polyclonal Antibody

Sign In for Pricing
View Details
SR-3D Polyclonal Antibody
RA30027-02 100 µL

SR-3D Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. ATP synthase subunit b'(atpG), partial
MBS7066458 Inquire

Recombinant Synechococcus sp. ATP synthase subunit b'(atpG), partial

Sign In for Pricing
View Details
GPI Antibody
GWB-A14C58 0.1 mL

GPI Antibody

Sign In for Pricing
View Details
Polyclonal CCR10 / GPR2 Antibody (aa350-362)
APR02461G 0.05mg

Polyclonal CCR10 / GPR2 Antibody (aa350-362)

Sign In for Pricing
View Details
Human Nuclear Antigen Antibody
orb248661-01 20 µg

Human Nuclear Antigen Antibody

Sign In for Pricing
View Details