Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC82 Peptide - C-terminal region

CCDC82 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC82, HT025

UniProt

Q8N4S0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC82 Rabbit Polyclonal Antibody (orb588042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb
MBS1881805-01 0.05 mg

Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb
MBS1881805-02 0.1 mg

Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb
MBS1881805-03 5x 0.1 mg

Biotinylated Anti-PD-1 (toripalimab biosimilar) mAb

Sign In for Pricing
View Details
TBCEL (AT1B10)
sc-517427 100 µg/mL

TBCEL (AT1B10)

Sign In for Pricing
View Details
Cavy Bile Acid-CoA:Amino Acid N-Acyltransferase (BAAT) ELISA Kit
MBS9362323 Inquire

Cavy Bile Acid-CoA:Amino Acid N-Acyltransferase (BAAT) ELISA Kit

Sign In for Pricing
View Details
LOC100362110 Protein Lysate (Rat) with C-HA Tag
26998036 100 µg

LOC100362110 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details