Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC82 Peptide - C-terminal region

CCDC82 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC82, HT025

UniProt

Q8N4S0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC82 Rabbit Polyclonal Antibody (orb588042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP9 Lentiviral Activation Particles (m)
sc-424940-LAC 200 µL

RP9 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
NAT1 Protein Lysate (Rat) with C-HA Tag
31467037 100 µg

NAT1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RPS6, NT (40S Ribosomal Protein S6, Phosphoprotein NP33, OK/SW-cl.2) (MaxLight 650) discontinued
R2031-30L-ML650 100 µL

RPS6, NT (40S Ribosomal Protein S6, Phosphoprotein NP33, OK/SW-cl.2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
anti-TB agent 1
MBS5766054 Inquire

anti-TB agent 1

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-01 48 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-02 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details