Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP78 Peptide - C-terminal region

CEP78 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CEP78, C9orf81

UniProt

Q5JTW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP78 Rabbit Polyclonal Antibody (orb588043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115547

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQRQESFEGFIARMCSPSPDATSGTGSQRKEEELSRNSRSSSEKKTKTES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTHM AAV siRNA Pooled Vector
17063161 1.0 µg

CTHM AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human INSYN1 shRNA (UAS) - Lentiviral human INSYN1 shRNA (UAS) (100)
GTR15333357 1 Vial

Lentiviral human INSYN1 shRNA (UAS) - Lentiviral human INSYN1 shRNA (UAS) (100)

Sign In for Pricing
View Details
CEP290 Antibody
orb2809490 100 µL

CEP290 Antibody

Sign In for Pricing
View Details
Nicastrin (m) : 293T Lysate
sc-122058 100 µg - 200 µL

Nicastrin (m) : 293T Lysate

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lysyl Oxidase Like Protein 1 (LOXL1)
MBS2076789-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Lysyl Oxidase Like Protein 1 (LOXL1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lysyl Oxidase Like Protein 1 (LOXL1)
MBS2076789-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Lysyl Oxidase Like Protein 1 (LOXL1)

Sign In for Pricing
View Details