Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAF Peptide - C-terminal region

MAF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAF

UniProt

O75444

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAF Rabbit Polyclonal Antibody (orb587887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit
ELK6323MS-01 48 Tests

Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit
ELK6323MS-02 96 Tests

Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit
ELK6323MS-03 5x 96 Tests

Human CTHRC1 (Collagen Triple Helix Repeat Containing Protein 1) Microsample ELISA Kit

Sign In for Pricing
View Details
MEMO1 polyclonal antibody
orb647336-01 50 μL

MEMO1 polyclonal antibody

Sign In for Pricing
View Details
MEMO1 polyclonal antibody
orb647336-02 100 µL

MEMO1 polyclonal antibody

Sign In for Pricing
View Details
MEMO1 polyclonal antibody
orb647336-03 200 µL

MEMO1 polyclonal antibody

Sign In for Pricing
View Details