Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAF Peptide - C-terminal region

MAF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAF

UniProt

O75444

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAF Rabbit Polyclonal Antibody (orb587887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken GCH1 ELISA Kit
ECKG0032 96 Tests

Chicken GCH1 ELISA Kit

Sign In for Pricing
View Details
Human anti-cardiolipin antibody (ACA) IgGA
A11C13-GA 1 Each

Human anti-cardiolipin antibody (ACA) IgGA

Sign In for Pricing
View Details
Acetyl-H mgB1-K29 pAb
E916002 100 µL

Acetyl-H mgB1-K29 pAb

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)
MBS1328515-01 0.02 mg (E-Coli)

Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)
MBS1328515-02 0.02 mg (Yeast)

Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)
MBS1328515-03 0.1 mg (E-Coli)

Recombinant Vibrio parahaemolyticus L-arabinose isomerase (araA)

Sign In for Pricing
View Details