Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS3 Peptide - N-terminal region

LGALS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LGALS3, MAC2

UniProt

P17931

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGALS3 Rabbit Polyclonal Antibody (orb331405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002297

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPI1, CT (Triosephosphate Isomerase, TIM, Triose-phosphate Isomerase, TPI) (AP) discontinued
T8489-84B-AP 200 µL

TPI1, CT (Triosephosphate Isomerase, TIM, Triose-phosphate Isomerase, TPI) (AP) discontinued

Sign In for Pricing
View Details
Nori® Human Cathelicidin ELISA Kit
GR111463 96 Well

Nori® Human Cathelicidin ELISA Kit

Sign In for Pricing
View Details
SNAPC4 Rabbit Polyclonal Antibody
orb3072179-01 30 µL

SNAPC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC4 Rabbit Polyclonal Antibody
orb3072179-02 50 µL

SNAPC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC4 Rabbit Polyclonal Antibody
orb3072179-03 100 µL

SNAPC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC4 Rabbit Polyclonal Antibody
orb3072179-04 200 µL

SNAPC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details