Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS3 Peptide - N-terminal region

LGALS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LGALS3, MAC2

UniProt

P17931

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGALS3 Rabbit Polyclonal Antibody (orb331405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002297

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RAB6C shRNA (UAS) - Lentiviral human RAB6C shRNA (UAS, iRFP) (100)
GTR15324510 1 Vial

Lentiviral human RAB6C shRNA (UAS) - Lentiviral human RAB6C shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TMIE Protein Vector (Human) (pPB-N-His)
PV059070 500 ng

TMIE Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal CD163L1 Antibody (CD163L1/7972) [DyLight 680]
NBP3-24185FR 0.1 mL

Mouse Monoclonal CD163L1 Antibody (CD163L1/7972) [DyLight 680]

Sign In for Pricing
View Details
FOXM1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody
MBS2402027-01 0.05 mL

FOXM1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details
FOXM1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody
MBS2402027-02 5x 0.05 mL

FOXM1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details
MGC12965 Adenovirus (Human)
28507051 1.0 mL

MGC12965 Adenovirus (Human)

Sign In for Pricing
View Details