Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MX2 Peptide - N-terminal region

MX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MX2

UniProt

P20592

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MX2 Rabbit Polyclonal Antibody (orb587907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005261043

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bismuth(III) Chloride
TRC-B497368-250MG 250 mg

Bismuth(III) Chloride

Sign In for Pricing
View Details
1-Aminohydantoin (AHD) -KLH Conjugate
50011-AAT 1 mg

1-Aminohydantoin (AHD) -KLH Conjugate

Sign In for Pricing
View Details
KRT18P28 Human qPCR Primer Pair (XM_291520)
HP221423 200 Reactions

KRT18P28 Human qPCR Primer Pair (XM_291520)

Sign In for Pricing
View Details
Human SPATA21 activation kit by CRISPRa
GA117796 1 Kit

Human SPATA21 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Benzylacrylic Acid
TRC-B224380-10G 10 g

2-Benzylacrylic Acid

Sign In for Pricing
View Details
PSMA2 Antibody
OC-2334-01 50 μL

PSMA2 Antibody

Sign In for Pricing
View Details