MX2 Peptide - N-terminal region
MX2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MX2
UniProt
P20592
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MX2 Rabbit Polyclonal Antibody (orb587907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005261043
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041802-100 1x 100 µL
CD40 / TNFRSF5 / CD40L-Receptor (T8P2G4*A6), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472466-100 1x 100 µL
Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
