Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARM1 Peptide - C-terminal region

CARM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CARM1, PRMT4

UniProt

Q86X55

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARM1 Rabbit Polyclonal Antibody (orb331407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005259765

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(N-Benzyl-N-ethyl) Amino-3-Hydroxyacetophenone Hydrochloride
TRC-B669560-1G 1 g

(N-Benzyl-N-ethyl) Amino-3-Hydroxyacetophenone Hydrochloride

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3102
BAVT-3102 1 Unit

Vertical Autoclave BAVT-3102

Sign In for Pricing
View Details
NKAP (NM_024528) Human Over-expression Lysate
LY402997 100 µg

NKAP (NM_024528) Human Over-expression Lysate

Sign In for Pricing
View Details
SEZ6L (NM_021115) Human Recombinant Protein
TP313624 20 µg

SEZ6L (NM_021115) Human Recombinant Protein

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1844), 0.2mg/mL
BNUB1844-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1844), 0.2mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), CF488A conjugate, 0.1mg/mL
BNC880317-100 1x 100 µL

CD1b (RIV12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details