Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARM1 Peptide - C-terminal region

CARM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CARM1, PRMT4

UniProt

Q86X55

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARM1 Rabbit Polyclonal Antibody (orb331407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005259765

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), 1mg/mL
BNUM2563-50 1x 50 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), 1mg/mL

Sign In for Pricing
View Details
Mouse Gal activation kit by CRISPRa
GA201531 1 Kit

Mouse Gal activation kit by CRISPRa

Sign In for Pricing
View Details
3,5-Dibromobenzaldehyde
TRC-D424200-5G 5 g

3,5-Dibromobenzaldehyde

Sign In for Pricing
View Details
Human SLC26A11 activation kit by CRISPRa
GA117101 1 Kit

Human SLC26A11 activation kit by CRISPRa

Sign In for Pricing
View Details
KIBRA (WWC1) (NM_001161661) Human Over-expression Lysate
LY431670 100 µg

KIBRA (WWC1) (NM_001161661) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CXCL10 / IP-10 Recombinant Rabbit monoclonal Antibody
HA725008 100 µL

Human CXCL10 / IP-10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details