Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATK Peptide - C-terminal region

MATK Peptide - C-terminal region

Product Specifications

Product Name Alternative

MATK, CTK, HYL

UniProt

P42679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MATK Rabbit Polyclonal Antibody (orb587909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_647612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS627733 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]
E-AB-F1146L-01 20 Tests

Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]
E-AB-F1146L-02 100 Tests

Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]
E-AB-F1146L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD11b Antibody[ICRF44]

Sign In for Pricing
View Details
Fcgr2b Rabbit Polyclonal Antibody
TA363327 100 µL

Fcgr2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF405S conjugate, 0.1mg/mL
BNC041832-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details