Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATK Peptide - C-terminal region

MATK Peptide - C-terminal region

Product Specifications

Product Name Alternative

MATK, CTK, HYL

UniProt

P42679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MATK Rabbit Polyclonal Antibody (orb587909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_647612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST1 (STK4) (C-term) Rabbit Polyclonal Antibody
AP14796PU-N 400 µL

MST1 (STK4) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tns4 Mouse Gene Knockout Kit (CRISPR)
KN518037 1 Kit

Tns4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Neurofilament,  40nm
GM-31-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Neurofilament, 40nm

Sign In for Pricing
View Details
Secnidazole Formate
TRC-S225005-50MG 50 mg

Secnidazole Formate

Sign In for Pricing
View Details
Abl1 Mouse Gene Knockout Kit (CRISPR)
KN500669 1 Kit

Abl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STXBP3 Antibody
KC-29004-01 50 μL

STXBP3 Antibody

Sign In for Pricing
View Details