Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Peptide - middle region

HOXB1 Peptide - middle region

Product Specifications

Product Name Alternative

HOXB1, HOX2I

UniProt

P14653

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXB1 Rabbit Polyclonal Antibody (orb587913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase IX (CA9/781), CF740 conjugate, 0.1mg/mL
BNC740781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100 alpha 6 (S100A6) Rabbit Polyclonal Antibody
TA361206 100 µL

S100 alpha 6 (S100A6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: OTI6C12]
CF807574 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI6C12]

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), 1mg/mL
BNUM3527-50 1x 50 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), 1mg/mL

Sign In for Pricing
View Details
TRIM40 Antibody
KC-2558-01 50 μL

TRIM40 Antibody

Sign In for Pricing
View Details
TRIM40 Antibody
KC-2558-02 100 µL

TRIM40 Antibody

Sign In for Pricing
View Details