Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Peptide - middle region

HOXB1 Peptide - middle region

Product Specifications

Product Name Alternative

HOXB1, HOX2I

UniProt

P14653

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXB1 Rabbit Polyclonal Antibody (orb587913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF11 Polyclonal Antibody
E-AB-11627-01 20 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-11627-02 60 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-11627-03 120 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-11627-04 200 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL
BNC942875-500 1x 500 µL

CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MAD2L2 Antibody
RC-6992-01 50 μL

Recombinant MAD2L2 Antibody

Sign In for Pricing
View Details