Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORC Peptide - middle region

RORC Peptide - middle region

Product Specifications

Product Name Alternative

RORC, NR1F3, RORG, RZRG

UniProt

P51449

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RORC Rabbit Polyclonal Antibody (orb331408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005051

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human HACE1 IP Antibody (SAA0202)
HP555013-01 50 µg

Anti-Human HACE1 IP Antibody (SAA0202)

Sign In for Pricing
View Details
Anti-Human HACE1 IP Antibody (SAA0202)
HP555013-02 100 µg

Anti-Human HACE1 IP Antibody (SAA0202)

Sign In for Pricing
View Details
Anti-Human HACE1 IP Antibody (SAA0202)
HP555013-03 1 mg

Anti-Human HACE1 IP Antibody (SAA0202)

Sign In for Pricing
View Details
Zebrafish GNAT1 Rabbit Polyclonal Antibody (Fluoro488)
orb3089384 100 µg

Zebrafish GNAT1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse IgG2a (LALA-PG), Isotype Control
HY-P99978A-01 1 mg

Mouse IgG2a (LALA-PG), Isotype Control

Sign In for Pricing
View Details
Mouse IgG2a (LALA-PG), Isotype Control
HY-P99978A-02 5 mg

Mouse IgG2a (LALA-PG), Isotype Control

Sign In for Pricing
View Details