Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORC Peptide - middle region

RORC Peptide - middle region

Product Specifications

Product Name Alternative

RORC, NR1F3, RORG, RZRG

UniProt

P51449

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RORC Rabbit Polyclonal Antibody (orb331408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005051

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7058-3p miRNA Mimic
CMM1588-01 5 nmol

Mmu-miR-7058-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-7058-3p miRNA Mimic
CMM1588-02 10 nmol

Mmu-miR-7058-3p miRNA Mimic

Sign In for Pricing
View Details
FGF1, NT (Heparin-binding Growth Factor 1, HBGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, FGFA) (MaxLight 550) discontinued
F4210-05-ML550 100 µL

FGF1, NT (Heparin-binding Growth Factor 1, HBGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, FGFA) (MaxLight 550) discontinued

Sign In for Pricing
View Details
IRGM, CT (IRGM, IFI1, IRGM1, LRG47, Immunity-related GTPase family M protein, Immunity-related GTPase family M protein 1, Interferon-inducible protein 1, LPS-stimulated RAW 264.7 macrophage protein 47 homolog) (MaxLight 650) discontinued
037108-ML650 100 µL

IRGM, CT (IRGM, IFI1, IRGM1, LRG47, Immunity-related GTPase family M protein, Immunity-related GTPase family M protein 1, Interferon-inducible protein 1, LPS-stimulated RAW 264.7 macrophage protein 47 homolog) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Human Putative PERP-like protein
MBS7038040-01 0.02 mg

Recombinant Human Putative PERP-like protein

Sign In for Pricing
View Details
Recombinant Human Putative PERP-like protein
MBS7038040-02 0.1 mg

Recombinant Human Putative PERP-like protein

Sign In for Pricing
View Details