Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1 Peptide - C-terminal region

TOM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOM1

UniProt

O60784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1 Rabbit Polyclonal Antibody (orb587925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005479

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Papaverine
TRC-P190503-10MG 10 mg

Papaverine

Sign In for Pricing
View Details
Fmoc-Arg (Pmc) TentaGel® S TRT Resin
SA1203.5G 5 g

Fmoc-Arg (Pmc) TentaGel® S TRT Resin

Sign In for Pricing
View Details
WDR5 (NM_017588) Human Over-expression Lysate
LC402599 20 µg

WDR5 (NM_017588) Human Over-expression Lysate

Sign In for Pricing
View Details
HTRA1 (NM_002775) Human Recombinant Protein
TP322362SE 20 µg

HTRA1 (NM_002775) Human Recombinant Protein

Sign In for Pricing
View Details
PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL
BNC683101-100 1x 100 µL

PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS701241 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details