TOM1 Peptide - C-terminal region
TOM1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TOM1
UniProt
O60784
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TOM1 Rabbit Polyclonal Antibody (orb587925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005479
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NQO2 Mouse Monoclonal Antibody [Clone ID: AT1E3]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc528/imageurl/am09380pu-n.webp)
AM09380PU-N 100 µL
NQO2 Mouse Monoclonal Antibody [Clone ID: AT1E3]
Sign In for Pricing
View Details 
BNC682081-500 1x 500 µL
Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550362-500 1x 500 µL
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681619-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details