Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCAN1 Peptide - C-terminal region

RCAN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCAN1, ADAPT78, CSP1, DSC1, DSCR1

UniProt

P53805

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCAN1 Rabbit Polyclonal Antibody (orb587929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor III (TGFBR3) (NM_003243) Human Tagged ORF Clone
RC216595 10 µg

TGF beta Receptor III (TGFBR3) (NM_003243) Human Tagged ORF Clone

Sign In for Pricing
View Details
Olfr56 shRNA (m) Lentiviral Particles
sc-150941-V 200 µL

Olfr56 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
4-Amino-6-chloropyridin-3-ol hydrochloride
KDC05837-01 50 mg

4-Amino-6-chloropyridin-3-ol hydrochloride

Sign In for Pricing
View Details
4-Amino-6-chloropyridin-3-ol hydrochloride
KDC05837-02 0.5 g

4-Amino-6-chloropyridin-3-ol hydrochloride

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd)
MBS1310007-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd)
MBS1310007-02 0.1 mg (E-Coli)

Recombinant Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details