Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCAN1 Peptide - C-terminal region

RCAN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCAN1, ADAPT78, CSP1, DSC1, DSCR1

UniProt

P53805

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCAN1 Rabbit Polyclonal Antibody (orb587929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMCD1 (NM_014583) Human 3' UTR Clone
SC207266 10 µg

LMCD1 (NM_014583) Human 3' UTR Clone

Sign In for Pricing
View Details
Goat anti-TPD52L1 / D53 Antibody
orb19573 100 µg

Goat anti-TPD52L1 / D53 Antibody

Sign In for Pricing
View Details
Marmoset OX40 Protein (Leu 29-Ala 214) [His]
VAng-2629Lsx-1mg 1 mg

Marmoset OX40 Protein (Leu 29-Ala 214) [His]

Sign In for Pricing
View Details
PPM1A CRISPRa sgRNA lentivector (set of three targets)(Rat)
37378126 3x 1.0µg DNA

PPM1A CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
SNFT (h) : 293T Lysate
sc-373308 100 µg - 200 µL

SNFT (h) : 293T Lysate

Sign In for Pricing
View Details
LZIC Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11638R-BF680 100 µL

LZIC Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details