Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1I3 Peptide - C-terminal region

NR1I3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NR1I3, CAR

UniProt

Q14994

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1I3 Rabbit Polyclonal Antibody (orb587934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal VPS11 Antibody [PerCP]
NBP2-04092PCP 0.1 mL

Rabbit Polyclonal VPS11 Antibody [PerCP]

Sign In for Pricing
View Details
Rabbit Monoclonal Complement C7 Antibody (009) [Alexa Fluor 700]
NBP2-90243AF700 0.1 mL

Rabbit Monoclonal Complement C7 Antibody (009) [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Spindle assembly checkpoint component MAD1 (MAD1), partial
MBS1482330 Inquire

Recombinant Ashbya gossypii Spindle assembly checkpoint component MAD1 (MAD1), partial

Sign In for Pricing
View Details
Anti-Human α4β7/ITGA4 & ITGB7 Antibody (SAA0020)
FHC98820 100 μg

Anti-Human α4β7/ITGA4 & ITGB7 Antibody (SAA0020)

Sign In for Pricing
View Details
OR7E36P AAV siRNA Pooled Vector
35609161 1.0 µg

OR7E36P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZNF215 (Zinc Finger Protein 215, BWSCR2-associated Zinc Finger Protein 2, BAZ2, BAZ-2, Zinc Finger Protein with KRAB and SCAN Domains 11, ZKSCAN11, ZSCAN43) (AP) discontinued
135636-AP 100 µL

ZNF215 (Zinc Finger Protein 215, BWSCR2-associated Zinc Finger Protein 2, BAZ2, BAZ-2, Zinc Finger Protein with KRAB and SCAN Domains 11, ZKSCAN11, ZSCAN43) (AP) discontinued

Sign In for Pricing
View Details