Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1I3 Peptide - C-terminal region

NR1I3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NR1I3, CAR

UniProt

Q14994

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1I3 Rabbit Polyclonal Antibody (orb587934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR8 Polyclonal Antibody
A57990-020 20 µL

ACTR8 Polyclonal Antibody

Sign In for Pricing
View Details
Human Raftlin (Raft Linking Protein) ELISA Kit
ELK9287-01 48 Tests

Human Raftlin (Raft Linking Protein) ELISA Kit

Sign In for Pricing
View Details
Human Raftlin (Raft Linking Protein) ELISA Kit
ELK9287-02 96 Tests

Human Raftlin (Raft Linking Protein) ELISA Kit

Sign In for Pricing
View Details
Human Raftlin (Raft Linking Protein) ELISA Kit
ELK9287-03 5x 96 Tests

Human Raftlin (Raft Linking Protein) ELISA Kit

Sign In for Pricing
View Details
ST8SIA4 (NM_005668) Human Tagged ORF Clone
RG208764 10 µg

ST8SIA4 (NM_005668) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sheep Olfactory receptor 4F17 (OR4F17) ELISA Kit
MBS7243634-01 48 Well

Sheep Olfactory receptor 4F17 (OR4F17) ELISA Kit

Sign In for Pricing
View Details