Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPH Peptide - C-terminal region

PRPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRPH, NEF4, PRPH1

UniProt

P41219

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPH Rabbit Polyclonal Antibody (orb587961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC47 Polyclonal Antibody
E-AB-18732-01 20 µL

CCDC47 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC47 Polyclonal Antibody
E-AB-18732-02 60 µL

CCDC47 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC47 Polyclonal Antibody
E-AB-18732-03 120 µL

CCDC47 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC47 Polyclonal Antibody
E-AB-18732-04 200 µL

CCDC47 Polyclonal Antibody

Sign In for Pricing
View Details
Orbital Shaker BSOR-108
BSOR-108 1 Unit

Orbital Shaker BSOR-108

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF488A conjugate, 0.1mg/mL
BNC882922-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details