Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPH Peptide - C-terminal region

PRPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRPH, NEF4, PRPH1

UniProt

P41219

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPH Rabbit Polyclonal Antibody (orb587961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBEAL2 Human Gene Knockout Kit (CRISPR)
KN424507 1 Kit

NBEAL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ddx3x activation kit by CRISPRa
GA201046 1 Kit

Mouse Ddx3x activation kit by CRISPRa

Sign In for Pricing
View Details
4,7-Dichloroquinoline
TRC-D436060-5G 5 g

4,7-Dichloroquinoline

Sign In for Pricing
View Details
CDk1 Rabbit Polyclonal Antibody
ER31213 100 µL

CDk1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF808 Human Gene Knockout Kit (CRISPR)
KN418729 1 Kit

ZNF808 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF405S conjugate, 0.1mg/mL
BNC042791-100 1x 100 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details