Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL3 Peptide - middle region

SH3GL3 Peptide - middle region

Product Specifications

Product Name Alternative

SH3GL3, CNSA3, SH3D2C

UniProt

Q99963

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3GL3 Rabbit Polyclonal Antibody (orb587964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fast Garnet GBC Salt
TRC-F101890-1G 1 g

Fast Garnet GBC Salt

Sign In for Pricing
View Details
Polystyrene A FMP
HA50056008.100G 100 g

Polystyrene A FMP

Sign In for Pricing
View Details
4-(3-Chlorophenyl)-4-oxo-2-butenoic Acid
TRC-C375120-5G 5 g

4-(3-Chlorophenyl)-4-oxo-2-butenoic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Gallbladder
CS800317 5x 5 µm

Tissue FFPE Sections, Gallbladder

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
ER1803-36 100 µL

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF740 conjugate, 0.1mg/mL
BNC742063-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details