Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL3 Peptide - middle region

SH3GL3 Peptide - middle region

Product Specifications

Product Name Alternative

SH3GL3, CNSA3, SH3D2C

UniProt

Q99963

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3GL3 Rabbit Polyclonal Antibody (orb587964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung: left upper lobe
CR562629 5 µg

Tissue Total RNA, Lung: left upper lobe

Sign In for Pricing
View Details
CD309 / VEGFR-2 / Flk-1 Rabbit Polyclonal Antibody
AP26035PU-L 200 µg

CD309 / VEGFR-2 / Flk-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha Lactalbumin (LALBA) (Center) Rabbit Polyclonal Antibody
AP52439PU-N 400 µL

alpha Lactalbumin (LALBA) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(1,2-Dithiolan-3-yl)ethan-1-amine Hydrochloride
TRC-D904160-75MG 75 mg

2-(1,2-Dithiolan-3-yl)ethan-1-amine Hydrochloride

Sign In for Pricing
View Details
Gepirone
TRC-G365000-10MG 10 mg

Gepirone

Sign In for Pricing
View Details
Human C16orf54 activation kit by CRISPRa
GA117068 1 Kit

Human C16orf54 activation kit by CRISPRa

Sign In for Pricing
View Details