SH3GL3 Peptide - C-terminal region
SH3GL3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SH3GL3, CNSA3, SH3D2C
UniProt
Q99963
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH3GL3 Rabbit Polyclonal Antibody (orb587968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003018
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1423043-01 0.02 mg (E-Coli)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details MBS1423043-02 0.02 mg (Yeast)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details MBS1423043-03 0.1 mg (E-Coli)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details MBS1423043-04 0.1 mg (Yeast)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details MBS1423043-05 0.02 mg (Baculovirus)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details MBS1423043-06 0.02 mg (Mammalian-Cell)
Recombinant Rat Pleckstrin homology domain-containing family F member 1 (Plekhf1)
Sign In for Pricing
View Details