Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIAO2A Peptide - C-terminal region

CIAO2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CIA2A, FAM96A

UniProt

Q9H5X1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIAO2A Rabbit Polyclonal Antibody (orb588038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115607

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1560909 Protein Vector (Rat) (pPM-C-HA)
39231026 500 ng

RGD1560909 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
5-Bromo-2-[ (2-chlorobenzyl) oxy]benzoic acid
sc-318274 500 mg

5-Bromo-2-[ (2-chlorobenzyl) oxy]benzoic acid

Sign In for Pricing
View Details
FAM53A Protein Vector (Mouse) (pPM-C-His)
PV177933 500 ng

FAM53A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ERO1A Antibody
orb678172 100 µL

ERO1A Antibody

Sign In for Pricing
View Details
Vkorc1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3988702 1.0 µg DNA

Vkorc1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mini Dry Bath Incubator (BDMI-114)
BDMI-114 1 Unit

Mini Dry Bath Incubator (BDMI-114)

Sign In for Pricing
View Details