Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM1 Peptide - C-terminal region

CEACAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CEACAM1, BGP, BGP1

UniProt

P13688

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM1 Rabbit Polyclonal Antibody (orb588051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001703

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Amyloid 1-40 (CT) Rabbit Polyclonal Antibody (BF647)
orb1816102 100 µL

Beta-Amyloid 1-40 (CT) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
9H-Fluorene, 4-bromo-9- (3-chlorophenyl) -9-phenyl-
JH919417 1 Each

9H-Fluorene, 4-bromo-9- (3-chlorophenyl) -9-phenyl-

Sign In for Pricing
View Details
TPP1 Antibody, Biotin conjugated
CSB-PA024113LD01HU-01 50 µg

TPP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TPP1 Antibody, Biotin conjugated
CSB-PA024113LD01HU-02 100 µg

TPP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ZSWIM6 Human Gene Knockout Kit (CRISPR)
KN427098 1 Kit

ZSWIM6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGFBI Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-54085R-BF350-TR 20 µL

TGFBI Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details